bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2748_orf2 Length=93 Score E Sequences producing significant alignments: (Bits) Value At3g22560 28.5 3.3 CE04961 28.1 3.8 Hs18491010 27.3 6.5 > At3g22560 Length=175 Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust. Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 9/74 (12%) Query 27 DEPRIYKERIYSLSKQ---LQYTGRNN-----RAEIRLCLSRKKKHCHSNGLPHTHRASL 78 + PRI+ R ++LS ++ G ++ R + L K+H + +PH R S+ Sbjct 4 ESPRIFL-RPFNLSDAEDVFKWAGDDDVTRYLRWDSVNSLEEAKQHILNKAIPHPWRRSI 62 Query 79 CSLRRGAKAGYINA 92 L+ G GY++ Sbjct 63 SLLQDGHSIGYVSV 76 > CE04961 Length=727 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%) Query 14 EPLRAFLHLIVAWDEPRIYKERIYS--LSKQLQYTGRNNRAEIRLCLSRKK 62 + +R LH+ A +E R+ ERI S LS ++ GR N EI L + Sbjct 400 QQVREELHISKALEEQRLADERIASEKLSIEMSRVGRQNELEIERALVESR 450 > Hs18491010 Length=1997 Score = 27.3 bits (59), Expect = 6.5, Method: Composition-based stats. Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 4/61 (6%) Query 37 YSLSKQ---LQYTGRNNRAEIRLCLSRKKKHCHSNGLPH-THRASLCSLRRGAKAGYINA 92 Y LSK+ L+ GRN +I L + K+ ++N LP+ R L ++ + YINA Sbjct 1701 YLLSKEYEELKDVGRNQSCDIALLPENRGKNRYNNILPYDATRVKLSNVDDDPCSDYINA 1760 Query 93 A 93 + Sbjct 1761 S 1761 Lambda K H 0.325 0.136 0.423 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1167934574 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40