bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2748_orf1 Length=90 Score E Sequences producing significant alignments: (Bits) Value YNL062c 30.8 0.60 Hs13775234 27.7 5.5 > YNL062c Length=478 Score = 30.8 bits (68), Expect = 0.60, Method: Composition-based stats. Identities = 23/70 (32%), Positives = 34/70 (48%), Gaps = 9/70 (12%) Query 5 QGSIKNGYIRSANNYNTQEGITELKFDFAFHGKRSIVTRMGYPTLT-----ALHCA---L 56 +G KN Y R YNTQ I EL +F + G + T + PTL +H + + Sbjct 329 KGGKKNSYYRKLRWYNTQWQILELTGEFLYDG-LVMATTLHLPTLVPKLAEKIHGSRPIV 387 Query 57 CAGEPKQDIL 66 C G+ K+ +L Sbjct 388 CYGQFKETLL 397 > Hs13775234 Length=481 Score = 27.7 bits (60), Expect = 5.5, Method: Compositional matrix adjust. Identities = 10/23 (43%), Positives = 15/23 (65%), Gaps = 0/23 (0%) Query 24 GITELKFDFAFHGKRSIVTRMGY 46 G T+ FDF+ HG+R + R+ Y Sbjct 49 GKTKRAFDFSAHGRRHVALRIAY 71 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1177758614 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40