bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2689_orf1 Length=114 Score E Sequences producing significant alignments: (Bits) Value At1g06110 28.1 4.1 Hs22060075 27.3 7.0 Hs4758032 26.9 9.1 > At1g06110 Length=428 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 17/63 (26%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Query 26 AALANNAFRAASSSRLAWACFCLNSLSSSNSIDSFFG---AFKGFFLPPWFPVGIVTQDW 82 A + + ++S W+ FC N L+ S +D +FK F + PW V V W Sbjct 26 VACVSKRLKVSASEESLWSIFCSNDLNISTPLDPHGDPAPSFKSFRMYPWNLVKRVRLCW 85 Query 83 EGI 85 + + Sbjct 86 DNL 88 > Hs22060075 Length=1069 Score = 27.3 bits (59), Expect = 7.0, Method: Composition-based stats. Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 1/50 (2%) Query 27 ALANNAFRAASSSRLAWACFCLNSLSSSNSIDSFFGAFKGFFLPPWFPVG 76 AL + FR + + + C LN L S++ S GA K + PW P G Sbjct 626 ALGESCFRPSGLNTPPY-CQVLNGLHLSSAHKSLAGAIKVKIMLPWGPAG 674 > Hs4758032 Length=906 Score = 26.9 bits (58), Expect = 9.1, Method: Composition-based stats. Identities = 24/97 (24%), Positives = 36/97 (37%), Gaps = 19/97 (19%) Query 20 FYFFLAAALANNAFRAASSSRLAWACFCLN-SLSSSNSIDSFFGAFK------------- 65 + + A AL N +F S+ AWA ++ SNSI F FK Sbjct 375 YIIYTAMALRNKSF--GSAQEFAWAHDSSEYAIRESNSIVKIFKNFKEKKSFKPDFGAES 432 Query 66 ---GFFLPPWFPVGIVTQDWEGITTLEFVRLQKSRLF 99 GF L G+ DW+ + + +Q +F Sbjct 433 IYGGFLLGVRSVNGLAFYDWDNTELIRRIEIQPKHIF 469 Lambda K H 0.325 0.134 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181971906 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40