bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2472_orf1 Length=89 Score E Sequences producing significant alignments: (Bits) Value At3g17040 26.9 8.1 > At3g17040 Length=652 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 30/62 (48%), Gaps = 8/62 (12%) Query 18 NASSPVSLMSSG-STSGRNSYVFPTLAPASLLSDRKNGQGVQGDLLVMCNTVLALCNESS 76 N S +L++ G GRN Y++ TLA L + K G+ Q L T+ CN S Sbjct 286 NISKARNLLAKGLKFCGRNEYIYQTLA----LLEAKAGRYEQARYLFKQATI---CNSRS 338 Query 77 CS 78 C+ Sbjct 339 CA 340 Lambda K H 0.311 0.125 0.347 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181033294 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40