bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2433_orf3 Length=341 Score E Sequences producing significant alignments: (Bits) Value At5g18510 33.9 0.57 SPBP22H7.05c 31.6 2.8 > At5g18510 Length=702 Score = 33.9 bits (76), Expect = 0.57, Method: Compositional matrix adjust. Identities = 24/91 (26%), Positives = 49/91 (53%), Gaps = 8/91 (8%) Query 52 MIGAIIQAVCACAGSESHAKQL-RLQRISLGVAAHFVSEQMGQESFVGSGGE------LV 104 ++G+ + + C+ A++L +++R SLG A VS++ SF+G GG+ LV Sbjct 134 VLGSPVFSPLECSEMRDSAEKLEKVRRDSLGKAKR-VSQRSWTSSFMGRGGQMEHEAFLV 192 Query 105 IMQALNTFPGEHSIAQLSCIIVNSIAMTSGD 135 + +L FPG+ + + +I ++ + G+ Sbjct 193 LWLSLFVFPGKFCRSISTNVIPIAVRLARGE 223 > SPBP22H7.05c Length=1201 Score = 31.6 bits (70), Expect = 2.8, Method: Compositional matrix adjust. Identities = 13/52 (25%), Positives = 28/52 (53%), Gaps = 0/52 (0%) Query 46 MGMDEVMIGAIIQAVCACAGSESHAKQLRLQRISLGVAAHFVSEQMGQESFV 97 + +DE++ ++ C + E KQL+ ++++ AH + E +E+FV Sbjct 1021 LNVDELIDAKLLYDCCQVSKREKAYKQLKQKKLNNAKDAHEMQESKNEETFV 1072 Lambda K H 0.315 0.131 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 8164591792 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40