bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2433_orf1 Length=159 Score E Sequences producing significant alignments: (Bits) Value SPAC17C9.16c 30.4 1.4 7298997 29.6 2.6 At5g03360 28.1 7.1 7291736 28.1 7.9 > SPAC17C9.16c Length=531 Score = 30.4 bits (67), Expect = 1.4, Method: Compositional matrix adjust. Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 18 SSPPLRRASFTCTGRSWTPLGYGSTFHCVI 47 +SP RA F TG S+ P+G+GST VI Sbjct 476 ASPLYARAMFNNTGPSYAPVGWGSTILGVI 505 > 7298997 Length=418 Score = 29.6 bits (65), Expect = 2.6, Method: Compositional matrix adjust. Identities = 12/25 (48%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 28 TCTGRSWTPLGYGSTFHCVIFKSNS 52 T T RS P G+G T HC+I N+ Sbjct 316 TATHRSTGPYGHGKTLHCIINAPNN 340 > At5g03360 Length=1610 Score = 28.1 bits (61), Expect = 7.1, Method: Compositional matrix adjust. Identities = 12/42 (28%), Positives = 19/42 (45%), Gaps = 0/42 (0%) Query 5 LIFSASLSPIYTLSSPPLRRASFTCTGRSWTPLGYGSTFHCV 46 L+ + + P++ S P R C SW L TF+C+ Sbjct 530 LVHESHMHPLFLTSEPYEARLCSVCKKESWLLLSTKETFNCI 571 > 7291736 Length=486 Score = 28.1 bits (61), Expect = 7.9, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 20/45 (44%), Gaps = 0/45 (0%) Query 28 TCTGRSWTPLGYGSTFHCVIFKSNSVTVEAKASMGSRFEPKASRV 72 TC G+ W P GYG +++ +T E AS P + + Sbjct 264 TCYGKKWGPHGYGFACGSSFLQTDGITEENLASERPFVAPDTTSI 308 Lambda K H 0.322 0.132 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2136300674 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40