bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2378_orf1 Length=83 Score E Sequences producing significant alignments: (Bits) Value YLR095c 28.5 3.5 7295330 27.3 7.5 Hs22042931 26.9 9.0 > YLR095c Length=812 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 12/31 (38%), Positives = 19/31 (61%), Gaps = 0/31 (0%) Query 28 LLLLFSLQIFSFKIFLTLFLHLFLFSSLLLD 58 ++ L ++ FK +L LHLF FS ++LD Sbjct 197 IIKLIEMKNMIFKNYLANNLHLFTFSEVILD 227 > 7295330 Length=741 Score = 27.3 bits (59), Expect = 7.5, Method: Compositional matrix adjust. Identities = 15/65 (23%), Positives = 32/65 (49%), Gaps = 8/65 (12%) Query 8 PWGHWTSGESTRSSLLLLQLLLLLFSLQIFSFKIFLTLFLHLFLFSSLLLDKRGLLRPPV 67 PW + ++ + L++L +F + ++ F++ FLF+ + +RG +R P+ Sbjct 70 PWADRLAAKNPNTFGKTLRVLTAVF--------LLISAFIYAFLFAVPEVTRRGEIREPL 121 Query 68 SDPGC 72 GC Sbjct 122 VSFGC 126 > Hs22042931 Length=251 Score = 26.9 bits (58), Expect = 9.0, Method: Compositional matrix adjust. Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 7/53 (13%) Query 34 LQIFSFKIFLTLFLHLFLFSSLLLDK-----RGLLRPPVSDPGCCLSVCGIKA 81 +Q FSF I +T FL +++ D+ + LL P + G C+ +C I+ Sbjct 99 IQFFSFAISVTT--ECFLLATMAYDRYVAICKPLLYPAIMTNGLCIRLCSIQV 149 Lambda K H 0.332 0.146 0.472 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1200681374 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40