bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2310_orf2 Length=78 Score E Sequences producing significant alignments: (Bits) Value CE04366 28.5 2.9 Hs4758678 27.3 6.8 > CE04366 Length=300 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 10/16 (62%), Positives = 14/16 (87%), Gaps = 0/16 (0%) Query 18 RFIFRQRLYEVTKQNV 33 +FIF+QR YE+ K+NV Sbjct 25 KFIFKQRRYEIVKENV 40 > Hs4758678 Length=1057 Score = 27.3 bits (59), Expect = 6.8, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 0/40 (0%) Query 28 VTKQNVFPSFTVCSSSTCHFFRLSAHYGCKILCLVELRPF 67 + + F FT+ S F+L+AH GC++ +V L F Sbjct 822 IASEEQFKVFTLPKVSAKTKFKLTAHEGCRVRKVVALATF 861 Lambda K H 0.333 0.140 0.515 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40