bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2310_orf1 Length=82 Score E Sequences producing significant alignments: (Bits) Value At1g20510 30.0 1.0 7301474 29.6 1.6 CE27958 27.7 5.4 > At1g20510 Length=546 Score = 30.0 bits (66), Expect = 1.0, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 39 AKDEAQPIDPTMYKALLERHRGSAWIRGPGITATFFS 75 A E + +DP + L + G W++GP I +FS Sbjct 369 ASMEGRIVDPVTGQILGPKQTGELWLKGPSIMKGYFS 405 > 7301474 Length=431 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 14/28 (50%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Query 21 TDCEAGKNVLFCYFIEPLAKDEAQPIDP 48 TD E G+ VL CY L + E QPI P Sbjct 403 TDAETGEQVLSCYL---LPQQEYQPITP 427 > CE27958 Length=348 Score = 27.7 bits (60), Expect = 5.4, Method: Composition-based stats. Identities = 18/52 (34%), Positives = 23/52 (44%), Gaps = 6/52 (11%) Query 17 CAATTDCEAGKNVLFCYFIEPLAKDEAQPI------DPTMYKALLERHRGSA 62 CAA + K+ C + + P+ DPT ALL RHRGSA Sbjct 158 CAAALKMRSSKSGAECVTCQRVYYPTFSPVSITLITDPTNEHALLVRHRGSA 209 Lambda K H 0.325 0.136 0.429 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1159278568 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40