bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2232_orf1 Length=112 Score E Sequences producing significant alignments: (Bits) Value At3g56410_1 30.4 0.86 Hs22069471_2 28.1 4.2 > At3g56410_1 Length=436 Score = 30.4 bits (67), Expect = 0.86, Method: Composition-based stats. Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 17 TCLACLAALGLPQAHPRGLRRIWQI 41 TC CL L LPQ P+G R+ +Q+ Sbjct 384 TCSYCLELLQLPQVSPQGKRQRYQV 408 > Hs22069471_2 Length=507 Score = 28.1 bits (61), Expect = 4.2, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Query 51 TTLSG---WISCIYEG-SLEQCNLPQLSLHICRLCKRQARVCLCTGVTPSEFL 99 +TL G W+SC + L+ +L L +H+CR ++ R LC T L Sbjct 85 STLRGSGLWLSCSLKAPGLQDRHLTSLQIHLCRQIMKEVRRALCNAATDDSKL 137 Lambda K H 0.328 0.140 0.479 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1188972946 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40