bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2219_orf3 Length=100 Score E Sequences producing significant alignments: (Bits) Value 7297199 32.0 0.27 Hs17452462 28.5 3.5 At3g26560 27.7 5.2 ECU10g0640 27.7 5.8 CE09563 27.3 6.8 At2g27360 26.9 8.9 7294908 26.9 9.6 > 7297199 Length=605 Score = 32.0 bits (71), Expect = 0.27, Method: Compositional matrix adjust. Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 0/45 (0%) Query 42 ALGVQALPDEREKRRGNLRQPEEVSSSSRTARMAVDRQLKMYKEL 86 A GVQ LP +LRQP E+ + +AV + L+M +L Sbjct 274 AFGVQVLPHANPLLDKSLRQPTEICEETYPTHLAVHKDLRMLLKL 318 > Hs17452462 Length=111 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 22/77 (28%), Positives = 36/77 (46%), Gaps = 8/77 (10%) Query 9 MLPQEHFHSACD--HKCSSVASVRGCERKAPD-LTRAL-----GVQALPDEREKRRGNLR 60 M+ H +S C+ + C S +SV+ + PD RAL G + P+E K +G+ Sbjct 24 MMHHLHTNSQCESSNTCPSGSSVQNSLKTIPDTFPRALDLTSNGTVSCPNEEYKLQGDAE 83 Query 61 QPEEVSSSSRTARMAVD 77 QP ++ R + D Sbjct 84 QPRGTEATERAKTNSKD 100 > At3g26560 Length=1168 Score = 27.7 bits (60), Expect = 5.2, Method: Composition-based stats. Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 3/53 (5%) Query 3 GDVAVLMLPQEHFHSACDHKCSSVASVRGCERKAPDLTRALGVQALPDEREKR 55 GD+ V + QE SAC S ++G + P+L ALP E + R Sbjct 724 GDILVFLTGQEEIDSACQ---SLYERMKGLGKNVPELIILPVYSALPSEMQSR 773 > ECU10g0640 Length=3151 Score = 27.7 bits (60), Expect = 5.8, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 46 QALPDEREKRRGNLRQPEEVSSSSRTARMAVDRQLKMYKELLQ 88 + + DE++ G R+ EE S+ R AVD++L + K LL+ Sbjct 2485 RQMEDEKKAIGGRKREMEEAFGLSQRRREAVDKRLGVAKALLE 2527 > CE09563 Length=326 Score = 27.3 bits (59), Expect = 6.8, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Query 53 EKRRGNLRQ-PEEVSSSSRTARMAVDRQLKMYKELLQSL 90 +K GNL++ PE S TAR+ +DR K ++ +L L Sbjct 125 QKFEGNLKELPEIQGESLPTARIFIDRPYKHFETILNFL 163 > At2g27360 Length=394 Score = 26.9 bits (58), Expect = 8.9, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 0/37 (0%) Query 63 EEVSSSSRTARMAVDRQLKMYKELLQSLCSSLHAECQ 99 EE + + +++ QLK +KE L LC S +C+ Sbjct 126 EEKGTHCSQSNISLGNQLKSFKESLPYLCGSSSPDCR 162 > 7294908 Length=1639 Score = 26.9 bits (58), Expect = 9.6, Method: Compositional matrix adjust. Identities = 17/45 (37%), Positives = 24/45 (53%), Gaps = 0/45 (0%) Query 34 RKAPDLTRALGVQALPDEREKRRGNLRQPEEVSSSSRTARMAVDR 78 ++A DL G QAL +EK +Q E++S SR AR D+ Sbjct 1172 QQALDLLNDEGAQALARAKEKSVEFGQQSEQISDISREARALADK 1216 Lambda K H 0.319 0.128 0.372 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187882580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40