bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2219_orf2 Length=162 Score E Sequences producing significant alignments: (Bits) Value CE02137 30.8 1.2 Hs22069354 29.3 3.4 7300639 28.9 5.2 At1g22010 28.5 5.5 > CE02137 Length=305 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 20/55 (36%), Positives = 26/55 (47%), Gaps = 9/55 (16%) Query 26 FSYLTFSV---------ETAAKRLQQLLVHLQLTIYRHSSCSAAAAYFLGLPQVS 71 FS+ +F V + A +RLQQL HLQL CSA F G+ + S Sbjct 234 FSFYSFFVLQCVLFLAQQRATRRLQQLSHHLQLLHIDEEVCSARVELFKGIAKTS 288 > Hs22069354 Length=280 Score = 29.3 bits (64), Expect = 3.4, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 96 TSPHRGYRAAFVVASAMKMLLWKHQDSNVTSPSGA 130 TSP R Y+A V+A +++ + ++S ++ P GA Sbjct 87 TSPQRRYKARPVIAPVLELRNMRTRESRLSEPEGA 121 > 7300639 Length=974 Score = 28.9 bits (63), Expect = 5.2, Method: Compositional matrix adjust. Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 11/69 (15%) Query 25 AFSYLTFSVETAAKRLQQLLVHLQLTIYRHSSCSAAAAYFLGLPQVSATLLTFIRKCLYT 84 AF LT +TA ++L L V ++ +HS CSA FL L QVS ++ Y Sbjct 234 AFFCLTLRNDTACQQLANLCVLSHFSLEKHSPCSA----FL-LTQVSDVVMK------YA 282 Query 85 QCTSQIRSL 93 Q+RSL Sbjct 283 HSGEQVRSL 291 > At1g22010 Length=163 Score = 28.5 bits (62), Expect = 5.5, Method: Compositional matrix adjust. Identities = 14/59 (23%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Query 33 VETAAKRLQQLLVHLQLTIYRHSSCSAAAAYFLGLPQVSATLLTFIRKCLYTQCTSQIR 91 V+ A + L +L+ HL L ++ + C A + ++ +S T + + +C+ ++ T+ R Sbjct 78 VDLARRELSRLVTHLMLYLHNYQDC--ALSIYITFKFISRTRVRILEQCVLSEMTTTSR 134 Lambda K H 0.324 0.130 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2244926132 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40