bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2136_orf1 Length=78 Score E Sequences producing significant alignments: (Bits) Value CE06289 29.6 1.4 7297786 28.1 4.4 > CE06289 Length=1791 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 0/48 (0%) Query 26 APAAPAAAAGAAAAAAVGKSAAAALLRKLLQTGHRDPLSPQKLQQTLN 73 AP PA A + AA+L+ + R PLS Q ++ TLN Sbjct 593 APPIPAEVTQTTDATVLSNHQTAAILQTITNMDIRYPLSSQNMKFTLN 640 > 7297786 Length=237 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 21/67 (31%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Query 7 LPAAAPTAAPAADLAAAPAAPAAPAAAAGAAAAAAVGKSAAAALLRKLLQTGHRDPLSPQ 66 A P A D ++ A AAG + AA AAAL+++ + G LSP+ Sbjct 150 FGAKWPVVAKFIDQYVPNSSGKIEAFAAGVSDLAASSYEKAAALIKEKVLVGR---LSPE 206 Query 67 KLQQTLN 73 + Q LN Sbjct 207 NINQALN 213 Lambda K H 0.312 0.121 0.342 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40