bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2038_orf2 Length=81 Score E Sequences producing significant alignments: (Bits) Value 7290761 28.5 3.1 At5g57320 28.1 3.6 CE29623 26.9 8.4 > 7290761 Length=2162 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 0/57 (0%) Query 16 SVVRATPSPHLLSCTYSSEYICICVWACHYVYKSFCILHYTLSPRLGKNVIMALMHT 72 ++ + P P L C+ + I + +Y+ F + +Y S R+ K +IMAL T Sbjct 180 TLYKQCPPPVLEECSKTLGLIGFINRKSYPIYEEFIVKNYKSSKRMQKYMIMALRAT 236 > At5g57320 Length=962 Score = 28.1 bits (61), Expect = 3.6, Method: Composition-based stats. Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 12/68 (17%) Query 12 FPFASVVRATPS-PHLLSCTYSSEYICICVWACHYVYKSFCILHYTLSPRLGKNVIMALM 70 +P + R S PHL SCTY++E + K+ I ++T + +++ + Sbjct 611 YPSQKIKRDGESDPHLFSCTYTNESL-----------KATEIFNFTQDDLMTEDIFILDC 659 Query 71 HTSVLVHI 78 HT V V + Sbjct 660 HTEVFVWV 667 > CE29623 Length=643 Score = 26.9 bits (58), Expect = 8.4, Method: Composition-based stats. Identities = 10/47 (21%), Positives = 26/47 (55%), Gaps = 3/47 (6%) Query 6 ESISNFFPFASVVRA---TPSPHLLSCTYSSEYICICVWACHYVYKS 49 E++ + ++ +++A TP H +SC S ++ + + C+ ++ S Sbjct 223 ETVGQYSVWSPLIKALGKTPPHHFVSCLLVSTFVSLSSYLCYKIFNS 269 Lambda K H 0.331 0.138 0.453 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1162440328 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40