bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2038_orf1 Length=77 Score E Sequences producing significant alignments: (Bits) Value At1g44090 27.7 5.6 At4g02190 27.3 7.4 7296333 27.3 7.5 > At1g44090 Length=385 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 19/55 (34%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Query 8 TFLVLRPSLSWSLS-LTFSHSRLWFGRLQAPTCLAVPIARNISAYVCGHATMFTS 61 TFLV+ L+ S L+FG + A I NIS Y GH+ F+S Sbjct 95 TFLVVNHGFKSGLAEKALEISSLFFGLSKDEKLRAYRIPGNISGYTAGHSQRFSS 149 > At4g02190 Length=659 Score = 27.3 bits (59), Expect = 7.4, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 20/40 (50%), Gaps = 0/40 (0%) Query 14 PSLSWSLSLTFSHSRLWFGRLQAPTCLAVPIARNISAYVC 53 PS+S+ S T H RL + TC A + + S Y+C Sbjct 236 PSISFEDSKTHDHQLTLLPRLDSFTCNACGLKGDRSPYIC 275 > 7296333 Length=260 Score = 27.3 bits (59), Expect = 7.5, Method: Composition-based stats. Identities = 10/23 (43%), Positives = 16/23 (69%), Gaps = 0/23 (0%) Query 44 IARNISAYVCGHATMFTSLFASS 66 I N+S +VC H T T++F+S+ Sbjct 179 IVENMSGFVCPHCTSCTNIFSSN 201 Lambda K H 0.330 0.135 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175087368 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40