bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2023_orf4 Length=118 Score E Sequences producing significant alignments: (Bits) Value Hs18587401 28.9 2.1 7292188 26.9 8.2 Hs22041471 26.9 8.9 CE06910 26.9 8.9 > Hs18587401 Length=226 Score = 28.9 bits (63), Expect = 2.1, Method: Compositional matrix adjust. Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 9/35 (25%) Query 2 GSEELFVLPSCLGNFSCFHFRQDLLHLLPALGVLR 36 GS +F+LPS L D LH LP LGVL+ Sbjct 182 GSSRMFLLPSNLN---------DQLHALPPLGVLK 207 > 7292188 Length=952 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 3/43 (6%) Query 12 CLG--NFSCFHFRQDLLHLLPALGVLRQQNGPEALLLLRCCCC 52 CLG + SC+ F+ L HLLP+L Q++ +LL CCC Sbjct 368 CLGATSLSCY-FQGKLYHLLPSLEAELQEHSVRSLLRTGSCCC 409 > Hs22041471 Length=605 Score = 26.9 bits (58), Expect = 8.9, Method: Composition-based stats. Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 0/20 (0%) Query 37 QQNGPEALLLLRCCCCCCCC 56 QQ+G + L RCC CC C Sbjct 417 QQHGALSRYLFRCCYCCFWC 436 > CE06910 Length=412 Score = 26.9 bits (58), Expect = 8.9, Method: Composition-based stats. Identities = 14/39 (35%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Query 16 FSCFHFRQDLLHLLPALGVLRQQNGPEALLLLRCCCCCC 54 FS F + H + L + Q N LL C CCCC Sbjct 328 FSMFFSANTMSHFIICLLISSQYNDTAKLL---CTCCCC 363 Lambda K H 0.334 0.147 0.524 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1167969826 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40