bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2023_orf1 Length=118 Score E Sequences producing significant alignments: (Bits) Value CE23850 31.6 0.40 At4g00090 30.8 0.63 Hs20543458 26.9 9.1 > CE23850 Length=550 Score = 31.6 bits (70), Expect = 0.40, Method: Composition-based stats. Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Query 24 KQLLQRCCCCFSSRPPASPLQRPRATTTAPSRGHPQQQQQQQQQQQQRSSSRAS 77 ++++ C C +PP L R + AP++ P+ ++QQQ+ +S RAS Sbjct 450 RKIVDHCVMCGYGKPPRLLLDRTK-VRWAPAQTRPEFERQQQRTAAAMTSRRAS 502 > At4g00090 Length=454 Score = 30.8 bits (68), Expect = 0.63, Method: Composition-based stats. Identities = 9/32 (28%), Positives = 18/32 (56%), Gaps = 0/32 (0%) Query 39 PASPLQRPRATTTAPSRGHPQQQQQQQQQQQQ 70 P P++ P++ AP + HP+ Q + Q ++ Sbjct 42 PQDPIRNPKSNHPAPKKNHPKSQASDKNQNKR 73 > Hs20543458 Length=484 Score = 26.9 bits (58), Expect = 9.1, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 10/53 (18%) Query 43 LQRPRATTTAPSRGH---PQ----QQQQQQQQQQQRSSSRASGP---FCCRKT 85 + R +T +PSRGH PQ + ++ +Q ++ SS+ GP CCR T Sbjct 35 ISRHDGSTVSPSRGHNLGPQLTRRKAERAEQSTKEESSASREGPNGFICCRTT 87 Lambda K H 0.320 0.127 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1167969826 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40