bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_2016_orf1 Length=92 Score E Sequences producing significant alignments: (Bits) Value CE24861 30.0 1.1 CE27296_1 28.5 2.8 > CE24861 Length=2208 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 4/77 (5%) Query 1 GFSASFRGPNSPQSARSRARRQHAAEPFSCCGHCHDCAASEQQQQQQQRSSSSRSSASCV 60 G++ S RG + R + +AE F+ CA + ++ Q+Q ++S S+ + Sbjct 183 GWTPSARGSHFTNRQYQLTRDEQSAECFTLATKAALCATTLEEALQRQMATSVPSTTANQ 242 Query 61 LPNLTASCFLHSSSCLP 77 PN + S SC+P Sbjct 243 TPNTLSP----SISCVP 255 > CE27296_1 Length=393 Score = 28.5 bits (62), Expect = 2.8, Method: Composition-based stats. Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 0/48 (0%) Query 40 SEQQQQQQQRSSSSRSSASCVLPNLTASCFLHSSSCLPRKCCSKTAAP 87 S Q +++ S SA V P++ +S F C +KT AP Sbjct 311 SSPDSSQSKKAVGSHPSARSVFPSMDSSVFTDDDGCEILHSTAKTCAP 358 Lambda K H 0.319 0.122 0.422 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171209254 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40