bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1998_orf4 Length=58 Score E Sequences producing significant alignments: (Bits) Value Hs20544584 30.4 0.75 At2g15580 28.1 3.8 > Hs20544584 Length=165 Score = 30.4 bits (67), Expect = 0.75, Method: Compositional matrix adjust. Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Query 21 PATAAAAASAIAAAAAHFYLRRRTKAIYMWKAQKKKK 57 P AA + + A + YL RT A YMW+ K KK Sbjct 126 PGMAATMMAVVGQADS--YLTNRTHAAYMWRGDKGKK 160 > At2g15580 Length=204 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 22/37 (59%), Gaps = 0/37 (0%) Query 12 RQRRACSSTPATAAAAASAIAAAAAHFYLRRRTKAIY 48 R+RR P ++ +++AAAA H + RR + ++Y Sbjct 12 RRRRFHGGAPPIESSNTASVAAAAGHVWTRRPSFSLY 48 Lambda K H 0.321 0.121 0.339 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187999082 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40