bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1998_orf3 Length=61 Score E Sequences producing significant alignments: (Bits) Value 7300571 28.1 4.5 > 7300571 Length=815 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 0/41 (0%) Query 1 FKCNVAARSMSCWCCGGIPDLRDTAAAGAAAAATATGVQQH 41 + C+V R S + +P RDTA + A+TA H Sbjct 75 YVCSVLLRCRSAYASVRLPVTRDTATGSGSGASTAASTPLH 115 Lambda K H 0.329 0.131 0.508 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178852562 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40