bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1973_orf5 Length=113 Score E Sequences producing significant alignments: (Bits) Value SPBC4F6.12 29.3 1.9 Hs17477796 27.7 5.4 At5g45480 26.9 9.4 > SPBC4F6.12 Length=438 Score = 29.3 bits (64), Expect = 1.9, Method: Composition-based stats. Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 7/43 (16%) Query 11 FASFRLGFIPSPRGGEVSARRARGERALPSVHSFHKTETNDKY 53 FAS +L +P + ++S RR P++HSFH N Y Sbjct 175 FASKQLPTLPLQKSSKLSNRR-------PALHSFHSAPANSLY 210 > Hs17477796 Length=448 Score = 27.7 bits (60), Expect = 5.4, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 19/35 (54%), Gaps = 0/35 (0%) Query 2 QLLLHFRAHFASFRLGFIPSPRGGEVSARRARGER 36 +L L RA A+ + G P PR + +RR RG R Sbjct 267 RLRLSTRAAVAAGKRGVFPEPRSPKAGSRRDRGRR 301 > At5g45480 Length=877 Score = 26.9 bits (58), Expect = 9.4, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Query 26 EVSARRARGERALPSVHSFHKTETNDKYIYLVLIYPVISASLVRIGKWR 74 E+ + +G +A S F K +D +YL+++ P + +++V IGK R Sbjct 683 ELLYQTKKGTKANHSAREFSKI-LSDYMMYLLMMQPTLMSAVVGIGKIR 730 Lambda K H 0.329 0.140 0.427 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1185472426 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40