bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1973_orf4 Length=100 Score E Sequences producing significant alignments: (Bits) Value 7292323 29.3 1.8 7295519 27.3 7.0 > 7292323 Length=1381 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 12/81 (14%) Query 20 RRNWTGPSARRPGATGRATPLAEFGLQVGVNLRGIYLQGYWALAEAGGRRFPRAAAPGFA 79 RRN S P TG + L G + R +YL + E ++ P + PG Sbjct 1237 RRNSVHGSLEAPDVTGSSLTLGTAGSR-----RTVYL-----IDEH--QKLPDGSTPGAT 1284 Query 80 RSSSVGCSSSRSGKLRNPRDP 100 +S SVG S S + P +P Sbjct 1285 QSQSVGGSGSVNAAPPTPAEP 1305 > 7295519 Length=852 Score = 27.3 bits (59), Expect = 7.0, Method: Compositional matrix adjust. Identities = 19/74 (25%), Positives = 33/74 (44%), Gaps = 10/74 (13%) Query 1 ESVTEPFKRSSR-RIWRSALRR---------NWTGPSARRPGATGRATPLAEFGLQVGVN 50 E+VT +R S ++W+ + R NW P A+ G GR+ L + ++ N Sbjct 677 EAVTADLQRESEEKLWQEGILRHVPVVGRVFNWWSPPAKESGIKGRSLNLTQGVVESTEN 736 Query 51 LRGIYLQGYWALAE 64 + ++Q A A Sbjct 737 IYKYHMQMTGATAH 750 Lambda K H 0.318 0.133 0.419 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187882580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40