bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1973_orf3 Length=103 Score E Sequences producing significant alignments: (Bits) Value Hs4758294_1 27.7 5.3 HsM7705539 26.9 8.1 Hs4759060 26.9 8.6 > Hs4758294_1 Length=941 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 20/68 (29%), Positives = 36/68 (52%), Gaps = 14/68 (20%) Query 5 RRRRARKAPPARLSQRPITLQIYSPQIYSNLKAKFSEWSGSSSRPGAPCRWTRPVSSQST 64 R+ +A K+P A++++ + + +LKA++ E +G PG P P+ SQS+ Sbjct 766 RKLKAEKSPKAKINE--------AVECLLSLKAQYKEKTGKEYIPGQP-----PL-SQSS 811 Query 65 SPDPSRAS 72 P+R S Sbjct 812 DSSPTRNS 819 > HsM7705539 Length=569 Score = 26.9 bits (58), Expect = 8.1, Method: Composition-based stats. Identities = 18/59 (30%), Positives = 26/59 (44%), Gaps = 1/59 (1%) Query 27 YSPQIYSNLKAKFSEWSGSSSRPGAPCRWTRPVSSQSTSPDPSRASLERFCHTFLPRPR 85 Y+P Y N K + W + A W+ + ST +PSRA ER + +PR Sbjct 487 YTPLTY-NKKYTYPWWGDALGWLLALSSWSAFLPGASTDSEPSRAPSERESVSSCAQPR 544 > Hs4759060 Length=1323 Score = 26.9 bits (58), Expect = 8.6, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 4/45 (8%) Query 55 WTRPVSSQSTSPDPSRASLERFCHTFLPRPRCECTGAYPGPACPP 99 W +S+ S SP+P+ + +C T P + + +GA P PP Sbjct 661 WENMMSASSQSPNPNNPA--EYCSTIPPLQQAQASGALSSP--PP 701 Lambda K H 0.318 0.130 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1177719780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40