bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1800_orf2 Length=78 Score E Sequences producing significant alignments: (Bits) Value Hs18379346 28.9 2.2 At1g73170 27.7 4.7 At3g23310 27.7 5.7 > Hs18379346 Length=1222 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 0/47 (0%) Query 22 KGGNRGGEPKIELKETAESGKKASRQADRIKRLKSAKRGLLPAPEKT 68 +GG RGGE ++E T+ +G++ R +L A+R P T Sbjct 93 QGGGRGGEMQVEAGGTSPAGERRGRGIPAPAKLGGARRSRRAQPPIT 139 > At1g73170 Length=652 Score = 27.7 bits (60), Expect = 4.7, Method: Compositional matrix adjust. Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 12/84 (14%) Query 3 GFPVAPNKTRSQAQMIRAWKG---------GNRGGEPKIELKETAESGKKASRQADRIKR 53 G PV KT S Q+ +A + G G E +++L E ++ ++A +RI Sbjct 499 GIPVYVTKTNSGIQVAKAIRALLTDYEDGLGEFGSEDRLKLSEKMDALEEARLAIERIVI 558 Query 54 LKSAKRGLLPAPEKTLRIVLLHSK 77 K LLP P RIV L K Sbjct 559 PKKETTDLLPRPP---RIVSLQGK 579 > At3g23310 Length=568 Score = 27.7 bits (60), Expect = 5.7, Method: Compositional matrix adjust. Identities = 11/25 (44%), Positives = 16/25 (64%), Gaps = 0/25 (0%) Query 2 SGFPVAPNKTRSQAQMIRAWKGGNR 26 G PVAP +TRSQ + ++ W+ R Sbjct 291 DGRPVAPRRTRSQMEQLQNWQRNRR 315 Lambda K H 0.311 0.129 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1171925608 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40