bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1800_orf1 Length=77 Score E Sequences producing significant alignments: (Bits) Value 7294567 27.3 6.6 At1g56140 26.9 9.7 > 7294567 Length=548 Score = 27.3 bits (59), Expect = 6.6, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 30/65 (46%), Gaps = 8/65 (12%) Query 19 CIREKPEQQ------HNGSFCSKMISSALQRLSPLQQQQSSRMSLCCAAAKGILLSAIGA 72 C E EQQ + G + + S L +S L+ S MS+C AK I++ +G Sbjct 192 CAFEVAEQQILLLGCNTGLYAYHLDSQRLVHISGLES--VSCMSICKRLAKAIMVGTVGE 249 Query 73 FLYSC 77 LY C Sbjct 250 KLYQC 254 > At1g56140 Length=2062 Score = 26.9 bits (58), Expect = 9.7, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 19/49 (38%), Gaps = 0/49 (0%) Query 17 GCCIREKPEQQHNGSFCSKMISSALQRLSPLQQQQSSRMSLCCAAAKGI 65 GCCI +K + AL LQ S R +C AKG+ Sbjct 722 GCCIEGNQRMLVYEYLSNKSLDQALFEEKSLQLGWSQRFEICLGVAKGL 770 Lambda K H 0.326 0.134 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1175087368 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40