bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1799_orf5 Length=56 Score E Sequences producing significant alignments: (Bits) Value Hs22051888 28.9 2.3 > Hs22051888 Length=203 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Query 1 KCLKLLEGKRLKLLFLRGAFGPQWPFPPILRYRGWGFLLLLW--PTTIPG 48 K L+ GK+ K RG Q PP+LR RG + W P++ PG Sbjct 137 KDLQPFSGKKKKPQMQRGFGSCQQTVPPVLRIRGLRIVRKFWKLPSSPPG 186 Lambda K H 0.329 0.151 0.552 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1194096762 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40