bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1799_orf2 Length=52 Score E Sequences producing significant alignments: (Bits) Value Hs22054677 28.5 2.7 Hs20562336 28.5 2.9 CE27290 27.3 7.7 > Hs22054677 Length=380 Score = 28.5 bits (62), Expect = 2.7, Method: Compositional matrix adjust. Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%) Query 3 TAATKTPNPYNGESGEKATAAQRHPGETKVSIASLPAISDTF-NSLSKVLF 52 T AT TP PY G++ T ++RHP + + P + DT ++LS L Sbjct 256 THATPTPTPYPGDT-HTHTLSRRHPHLIQATPTPTPYLGDTHAHTLSGFLH 305 > Hs20562336 Length=1065 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 0/38 (0%) Query 3 TAATKTPNPYNGESGEKATAAQRHPGETKVSIASLPAI 40 TAAT P+P +GESG+ + + P K+ +P + Sbjct 141 TAATPPPSPTSGESGDLLSNLLQSPSSAKLLNQPIPIL 178 > CE27290 Length=581 Score = 27.3 bits (59), Expect = 7.7, Method: Composition-based stats. Identities = 12/23 (52%), Positives = 12/23 (52%), Gaps = 0/23 (0%) Query 8 TPNPYNGESGEKATAAQRHPGET 30 TPNPY GE G A PG T Sbjct 475 TPNPYTGEGGISARGDLNTPGGT 497 Lambda K H 0.306 0.120 0.343 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1158678716 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40