bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1775_orf5 Length=146 Score E Sequences producing significant alignments: (Bits) Value SPBC18H10.16 30.8 1.00 At5g17010 30.4 1.3 CE17243 30.0 1.4 Hs22043979 28.9 4.0 At1g70940 28.1 6.3 7290288 28.1 6.3 At1g15620 27.7 7.3 > SPBC18H10.16 Length=1050 Score = 30.8 bits (68), Expect = 1.00, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 0/37 (0%) Query 28 LQQVSPESFIFLLLFFIKRLAICCCCCCCSFATFCFA 64 + Q PE + ++ L+ LA+CC CC A F A Sbjct 194 ISQFLPEGYWWVFLYTTCVLAMCCILCCLGSAIFAKA 230 > At5g17010 Length=440 Score = 30.4 bits (67), Expect = 1.3, Method: Composition-based stats. Identities = 15/39 (38%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Query 39 LLLFFIKRLAICCCCCCCSFATFCFAFPRI-PQRIAGRG 76 LLL + + + CCC C+ A C P I P ++ GRG Sbjct 337 LLLGGVGGMRLTSCCCSCT-AALCGLLPEIFPLKLRGRG 374 > CE17243 Length=553 Score = 30.0 bits (66), Expect = 1.4, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 31/74 (41%), Gaps = 9/74 (12%) Query 50 CCCCCCCSFATFCFAFPRIPQRIAGRGGGGCSCSHSAQANLNWNLNSNLNLNLNLNFSEL 109 C C C+ + R A R GGC+C+H+ AN + +L + Sbjct 57 CTACSQCTENGYSVCL-RPKDSRASRTAGGCTCAHTLAANCHTDLAQTQH--------PA 107 Query 110 NSNSKSYLNCKANS 123 N + K+Y C A++ Sbjct 108 NLSMKTYSACYADA 121 > Hs22043979 Length=221 Score = 28.9 bits (63), Expect = 4.0, Method: Compositional matrix adjust. Identities = 19/53 (35%), Positives = 23/53 (43%), Gaps = 5/53 (9%) Query 45 KRLAICCCCCCCSFATFCFAFPRIPQRIAG--RGGGGCSCSHSAQANLNWNLN 95 K L C CS CF P P+R+ G GGG H A A+ WN + Sbjct 9 KHLVETECELSCS--ELCFRLPPQPRRLLGLQVSGGGLKLQHPA-ADTFWNFS 58 > At1g70940 Length=640 Score = 28.1 bits (61), Expect = 6.3, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 24/53 (45%), Gaps = 0/53 (0%) Query 77 GGGCSCSHSAQANLNWNLNSNLNLNLNLNFSELNSNSKSYLNCKANSNSQDKR 129 GGG + + S N ++N N ++N+N ++ L SNS D + Sbjct 302 GGGAGSYPAPNPEFSSTTTSTANKSVNKNPKDVNTNQQTTLPTGGKSNSHDAK 354 > 7290288 Length=715 Score = 28.1 bits (61), Expect = 6.3, Method: Composition-based stats. Identities = 23/74 (31%), Positives = 37/74 (50%), Gaps = 3/74 (4%) Query 65 FPRIPQRIAGRGGGGCSC-SHSAQANLNWNLNSNLNLNLNLNFSELNSNSKSYLNCKANS 123 + ++PQR GG C S+S NL NLN+N N +N L + ++ + K+ S Sbjct 347 YLQLPQRTDTAVSGGALCRSNSVGHNLKPNLNNNSNGAVNGQGPTLVTPPQAVV--KSTS 404 Query 124 NSQDKRGTNSESKL 137 N R +S+ +L Sbjct 405 NDDIARKCHSQLQL 418 > At1g15620 Length=343 Score = 27.7 bits (60), Expect = 7.3, Method: Compositional matrix adjust. Identities = 9/21 (42%), Positives = 12/21 (57%), Gaps = 0/21 (0%) Query 43 FIKRLAICCCCCCCSFATFCF 63 ++ + IC CCC F T CF Sbjct 318 YVLPMVICAATCCCVFMTLCF 338 Lambda K H 0.325 0.137 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1748847648 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40