bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1775_orf4 Length=115 Score E Sequences producing significant alignments: (Bits) Value CE27920 30.4 0.75 Hs13325075 28.5 2.9 Hs13376874 28.1 4.4 CE23507 28.1 4.4 At3g03290 27.7 5.5 > CE27920 Length=1280 Score = 30.4 bits (67), Expect = 0.75, Method: Composition-based stats. Identities = 13/33 (39%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Query 23 FQFKFACAEWLQLQPPPPRPAIRCGIRGKAKQK 55 QFK + +WL+ +PPP P CG G+ +K Sbjct 561 LQFKSSRIQWLKGEPPPDEPV--CGFHGENCRK 591 > Hs13325075 Length=747 Score = 28.5 bits (62), Expect = 2.9, Method: Compositional matrix adjust. Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 12/71 (16%) Query 36 QPPPPRPAIRCGIRGKAKQKVAKLQQQQQQQI------------ASLLIKNRSKKMKLSG 83 +PP P +R + + +A+LQ+ +Q+Q A+LL ++R++K +L G Sbjct 605 RPPKLHPGLRAAPGQEPPEHMAELQRNEQEQPLGQWHLSKRDTGAALLAESRAEKNRLWG 664 Query 84 ETCCRKSGCSS 94 R+ G SS Sbjct 665 PLEVRRVGRSS 675 > Hs13376874 Length=125 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query 76 SKKMKLS-GETCCRKSGCSSSSRRRRPRLGKTNLPALA 112 ++K+ L+ TCC K C+S+ R P LG L +LA Sbjct 80 NRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLA 117 > CE23507 Length=1375 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Query 48 IRGKAKQKVAKLQQQQQQQIASLLIKNRSKKMKLSGE----TCCRKSGCSSSS 96 +R K +++ +Q+QQQ + L+ NR K G T SGC S+S Sbjct 1107 LRKKHQKQRDSIQKQQQTNVDKLITNNRRSTKKEKGSRRSLTASVSSGCGSAS 1159 > At3g03290 Length=274 Score = 27.7 bits (60), Expect = 5.5, Method: Compositional matrix adjust. Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 3/41 (7%) Query 41 RPAIRCGIR---GKAKQKVAKLQQQQQQQIASLLIKNRSKK 78 RP I IR GK K+K K+ ++ ++Q SLL+ + KK Sbjct 174 RPGIEVEIRRLQGKEKEKGEKIVEEAKEQQVSLLVVGKEKK 214 Lambda K H 0.324 0.134 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178471386 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40