bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1775_orf3 Length=139 Score E Sequences producing significant alignments: (Bits) Value At5g58690 28.9 3.1 Hs22060418 28.5 3.9 CE17862 28.1 4.8 7301816 27.3 9.1 > At5g58690 Length=568 Score = 28.9 bits (63), Expect = 3.1, Method: Composition-based stats. Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%) Query 33 AAAPASDSLRNSGESEAK-SGKTAAAAAAADRKSFDKEQKQKNE 75 + P SLR +SE+ SGK ++ +A D K+ ++ + KNE Sbjct 250 STKPPKGSLRKDKDSESDASGKASSDVSADDEKTEEETSEAKNE 293 > Hs22060418 Length=443 Score = 28.5 bits (62), Expect = 3.9, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Query 83 QEIGVQQQQ-PPPPPKTWKDKLACFG 107 QE GV + PPP P +W LAC G Sbjct 46 QEAGVTMPEVPPPEPHSWSTLLACPG 71 > CE17862 Length=1378 Score = 28.1 bits (61), Expect = 4.8, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 1/34 (2%) Query 68 KEQKQKNEAFWRNLLQEIGVQQQQP-PPPPKTWK 100 + K+K A R++L+ GV +Q P PPPPK K Sbjct 1228 RSAKRKANAAMRDVLEFEGVLRQTPAPPPPKRQK 1261 > 7301816 Length=1537 Score = 27.3 bits (59), Expect = 9.1, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 43/83 (51%), Gaps = 7/83 (8%) Query 10 IQVQIRVQVPVQVRLR-----RMAAAAAAAAPASDSLRNSGESEA--KSGKTAAAAAAAD 62 + +R +VP + ++R + A A A+ RN+ +S A + KT + A A Sbjct 986 VHTAVRTKVPFKKKVRGERTKKPGTGAGVTAAAAVGTRNAAKSSANPEPKKTTRSQAMAK 1045 Query 63 RKSFDKEQKQKNEAFWRNLLQEI 85 +KSF++E K+ ++ +++ + I Sbjct 1046 KKSFEEEPKKSSKKVGKHMKEII 1068 Lambda K H 0.319 0.129 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1534984332 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40