bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1775_orf2 Length=103 Score E Sequences producing significant alignments: (Bits) Value Hs18582545 30.0 1.00 Hs5902072 29.3 1.8 YJL089w 28.5 3.1 Hs17454125 28.1 3.8 7296040 28.1 3.9 CE14828 28.1 4.1 At4g02570 27.3 7.4 At2g13020 27.3 7.9 > Hs18582545 Length=133 Score = 30.0 bits (66), Expect = 1.00, Method: Compositional matrix adjust. Identities = 16/62 (25%), Positives = 27/62 (43%), Gaps = 0/62 (0%) Query 28 AGVAALRRPAAFWCFRIFSSFWPFKTEFKPITPFRSLFTFHFNSRSSLKPLSIPRSRRRR 87 V +R+PA + S+FW F P TP + H N + S + S+ ++ Sbjct 27 CDVCTVRKPAFLLLSNLGSAFWNFSALIFPHTPLTATTYHHHNPKQSKQTESLNKNLHLG 86 Query 88 RR 89 +R Sbjct 87 KR 88 > Hs5902072 Length=390 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 2/36 (5%) Query 48 FWPFKTEFKPITPFRSLFTFHFNSRSSL--KPLSIP 81 FWP K +K I R +FHF S + K L IP Sbjct 200 FWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIP 235 > YJL089w Length=829 Score = 28.5 bits (62), Expect = 3.1, Method: Composition-based stats. Identities = 16/48 (33%), Positives = 21/48 (43%), Gaps = 5/48 (10%) Query 35 RPAAFWCFRIFSSFWPFKTEFKPITPFRSLFTFHFNSRSSLKPLSIPR 82 R FWCF+ SS+W P + T F + S+ L IPR Sbjct 364 RIVTFWCFQFLSSWWSLIQGL----PKSNFLTEEFQPK-SISVLEIPR 406 > Hs17454125 Length=1849 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 16/27 (59%), Gaps = 0/27 (0%) Query 54 EFKPITPFRSLFTFHFNSRSSLKPLSI 80 E KP L FH NS+S+L+ +S+ Sbjct 703 EIKPAESLGQLLLFHLNSKSALQRISV 729 > 7296040 Length=1201 Score = 28.1 bits (61), Expect = 3.9, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Query 55 FKPITPFRSLFTFHFNSRSSL--KPLSIPRSRRRRRRSSSI 93 F PI P+R+ T H S+ L K + IP S R +S+SI Sbjct 1040 FLPIPPWRNCNTSHIPSKFCLCHKQIPIPESNRVVTKSASI 1080 > CE14828 Length=211 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 9/23 (39%), Positives = 13/23 (56%), Gaps = 0/23 (0%) Query 34 RRPAAFWCFRIFSSFWPFKTEFK 56 RP+ WC R+F F KT+ + Sbjct 48 NRPSGGWCMRVFEGFNAAKTDAE 70 > At4g02570 Length=676 Score = 27.3 bits (59), Expect = 7.4, Method: Composition-based stats. Identities = 12/40 (30%), Positives = 20/40 (50%), Gaps = 0/40 (0%) Query 41 CFRIFSSFWPFKTEFKPITPFRSLFTFHFNSRSSLKPLSI 80 C +F F+ KT+ + +T SL T H N + K + + Sbjct 469 CVEVFKGFYETKTKHRKLTWIYSLGTCHINGKFDQKAIEL 508 > At2g13020 Length=930 Score = 27.3 bits (59), Expect = 7.9, Method: Compositional matrix adjust. Identities = 10/29 (34%), Positives = 17/29 (58%), Gaps = 3/29 (10%) Query 40 WCFRIFSSFWPFKTEFKP---ITPFRSLF 65 W ++++ + W +KT FK TPF L+ Sbjct 389 WSYKLYDALWAYKTAFKTPLGTTPFHLLY 417 Lambda K H 0.338 0.146 0.484 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1177719780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40