bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1711_orf1 Length=374 Score E Sequences producing significant alignments: (Bits) Value Hs17489480 32.0 2.1 At3g09450 31.6 2.9 Hs22067216 30.8 4.6 > Hs17489480 Length=119 Score = 32.0 bits (71), Expect = 2.1, Method: Composition-based stats. Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 13/75 (17%) Query 50 NNLRQSLFNFVRLGSLERLSCGNLNLLSSILASCYCSIDVIVAGAFYRCGNTAMAEKQDL 109 NN LFN + +G G NLL + I++G F A+AEK DL Sbjct 5 NNENDYLFNVILIGDS---GVGKNNLL----------VIYIISGKFLELKARALAEKNDL 51 Query 110 PQLVTEAGDKTDLEA 124 + T A D T++EA Sbjct 52 SFIETSALDSTNVEA 66 > At3g09450 Length=775 Score = 31.6 bits (70), Expect = 2.9, Method: Compositional matrix adjust. Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 0/39 (0%) Query 212 PQTADEPEQAHPTSGEDSEGWHEELPSLPVSPIPAAFGK 250 P+T P +DS GWH E SL + +P F + Sbjct 295 PRTHIAPRSESTLKSQDSLGWHHEAESLSTAALPVCFFR 333 > Hs22067216 Length=553 Score = 30.8 bits (68), Expect = 4.6, Method: Compositional matrix adjust. Identities = 26/109 (23%), Positives = 45/109 (41%), Gaps = 17/109 (15%) Query 117 GDKTDLEAGGASNGDSEDDSPFTSSRSACGHGTKRPRIRAKRLLLNLLLGLVAVAVVASH 176 G + L A G S +S+ +CG +R + + ++L + + Sbjct 99 GFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKKQQL-----------ELAKKY 147 Query 177 VRLIRATLRKHQAYRSVVPHKERPEISHDVEYAPLPQTA----DEPEQA 221 ++L+R + Q YRS +P +P H V P+ + A D PE A Sbjct 148 LQLLRTS--AQQRYRSQIPGSGQPHAFHQVYVPPILRRATASLDTPEGA 194 Lambda K H 0.314 0.132 0.380 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 9260931504 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40