bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1636_orf1 Length=108 Score E Sequences producing significant alignments: (Bits) Value At1g58350 30.0 1.1 At4g38940 28.5 3.0 CE23568 27.7 5.9 Hs22048336_1 27.3 6.4 CE27472 27.3 6.8 CE08708 26.9 9.6 > At1g58350 Length=794 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 4/62 (6%) Query 15 NSAATSSFSACAALSCFWRELQRCSSSRRSVVASPRVLLSSSSLLLEALLLLAAAVGRTK 74 NS S SA F + L +S+ + +V+ + LL + +LLE + L+ AVG+T Sbjct 227 NSKNVSGSSA----QSFKKALGLLASADKKLVSFVKALLGARGILLEEMQRLSKAVGQTI 282 Query 75 DL 76 DL Sbjct 283 DL 284 > At4g38940 Length=370 Score = 28.5 bits (62), Expect = 3.0, Method: Composition-based stats. Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 1/66 (1%) Query 30 CFWRELQRCSSSRRSVVASPRVLLSSSSL-LLEALLLLAAAVGRTKDLLLFPLFRLAERN 88 C++ L + S RS+VASP + S E L +A + +T D+ F L R Sbjct 39 CYYPTLSQVSRRFRSLVASPEIYKRRSFFGCTEQCLYIAISKDQTSDIHWFTLCRKPNGQ 98 Query 89 ACSGIS 94 SG + Sbjct 99 QFSGTT 104 > CE23568 Length=215 Score = 27.7 bits (60), Expect = 5.9, Method: Compositional matrix adjust. Identities = 20/65 (30%), Positives = 37/65 (56%), Gaps = 6/65 (9%) Query 48 SPRVLLSSSSLLLEALLLLAAAVGRTKD--LLLFP--LFRLAERNACSGISKLSLDGKNS 103 SPR L + + L + ++LL AA G ++ +L+FP + + + C+G++ LSL + Sbjct 40 SPRDL--AQAYLADVIVLLLAAFGTARNLPILIFPSVIVKFICFSLCAGVAMLSLSETSI 97 Query 104 NHGSK 108 N +K Sbjct 98 NMKTK 102 > Hs22048336_1 Length=355 Score = 27.3 bits (59), Expect = 6.4, Method: Compositional matrix adjust. Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 9/62 (14%) Query 32 WRELQRCSSSRRSVVASPRVLL--SSSSLLLEALLL-------LAAAVGRTKDLLLFPLF 82 RE SSSR+S+ R+LL + L + ++L LAA +G+ DLL FP+ Sbjct 179 QREAPGTSSSRKSLKTPRRILLIKNMDPRLQQTVVLSHRNTRNLAAFLGKASDLLRFPVK 238 Query 83 RL 84 +L Sbjct 239 QL 240 > CE27472 Length=1334 Score = 27.3 bits (59), Expect = 6.8, Method: Compositional matrix adjust. Identities = 26/82 (31%), Positives = 39/82 (47%), Gaps = 14/82 (17%) Query 11 IHCFNSAATSSFSACAALSCFWRELQR--CSSSRRSVVASPRVLLSSSSLLLEALLLLAA 68 + CF A + S C+AL C R LQR C S+ + +++LLL AL L A Sbjct 331 LKCF--AISDSMVKCSALQCLHRALQRQPCDSA---------LPTETNALLLTALRQLGA 379 Query 69 AVGRTKDLLLFPLFRLAERNAC 90 +V + + + LAE + C Sbjct 380 SVTDVT-VTAYWMQALAEAHVC 400 > CE08708 Length=378 Score = 26.9 bits (58), Expect = 9.6, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Query 31 FWRELQRCSSSRRSVVASPRVLLSSSSLLLEALLLLAAAVGRTKDLLLFPL 81 FW E R + R+ V+ + + LL+E L L A + + LLFP+ Sbjct 188 FWYECVRAINGRQYVMVISK-FYRHNKLLIELLETLNALISKISPCLLFPI 237 Lambda K H 0.322 0.131 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1160781780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40