bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_1585_orf2 Length=63 Score E Sequences producing significant alignments: (Bits) Value Hs20538457 29.3 1.6 Hs12225240 29.3 1.6 > Hs20538457 Length=2570 Score = 29.3 bits (64), Expect = 1.6, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 28/61 (45%), Gaps = 12/61 (19%) Query 7 GLIHSRVDTRQRA---TPRHDVKRLSRLILAS---FFRFSD-----SLPAYLSGPSPFTF 55 G+ H R +A TP D KR ILAS F RF LP+ L GP PFT Sbjct 485 GVFHVVTGLRWQAPSGTP-GDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGPFTV 543 Query 56 F 56 F Sbjct 544 F 544 > Hs12225240 Length=2570 Score = 29.3 bits (64), Expect = 1.6, Method: Composition-based stats. Identities = 25/61 (40%), Positives = 28/61 (45%), Gaps = 12/61 (19%) Query 7 GLIHSRVDTRQRA---TPRHDVKRLSRLILAS---FFRFSD-----SLPAYLSGPSPFTF 55 G+ H R +A TP D KR ILAS F RF LP+ L GP PFT Sbjct 485 GVFHVVTGLRWQAPSGTP-GDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGPFTV 543 Query 56 F 56 F Sbjct 544 F 544 Lambda K H 0.333 0.145 0.434 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1172754882 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40