bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0862_orf1 Length=101 Score E Sequences producing significant alignments: (Bits) Value SPAC25B8.05 30.8 0.57 7291270 28.9 2.2 CE28547 28.1 3.8 CE00946 28.1 4.1 At4g02990 28.1 4.1 CE26874 26.9 9.1 > SPAC25B8.05 Length=450 Score = 30.8 bits (68), Expect = 0.57, Method: Composition-based stats. Identities = 14/33 (42%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 25 RLRRVVRALCNSVSGNHRHSERRPAVQCGLLDQ 57 R + V A+ +S N RHSERRP + C +L++ Sbjct 147 RTDKGVSAMGQVISLNVRHSERRPIIYCDVLNR 179 > 7291270 Length=587 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 0/54 (0%) Query 42 RHSERRPAVQCGLLDQCDSSSRETRPRQLQRRCTGKELHRTEVKQLEKYESEER 95 R E+ + LLD+ S R RP ++ TG+EL + ++L++ +R Sbjct 260 RRCEKMAEAESNLLDRKKSIVRLQRPSEMSGISTGQELDQDNERELKRISRHQR 313 > CE28547 Length=984 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 26/77 (33%), Positives = 37/77 (48%), Gaps = 4/77 (5%) Query 3 RGRGRGAGIFPE---SETSRVRELRRLRRVVRALCNSVSGNHRHSERRPAVQCGLLDQCD 59 RGRGRG + P S +RV+E RR R NS + +H+ R +Q + Sbjct 472 RGRGRGESLSPSVRRSPVARVKE-RRADIRQRHASNSSAASHQEKPSREEIQRQIGTASR 530 Query 60 SSSRETRPRQLQRRCTG 76 SS ETR R L+++ Sbjct 531 ISSDETRLRSLEQQVDN 547 > CE00946 Length=2528 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 0/35 (0%) Query 30 VRALCNSVSGNHRHSERRPAVQCGLLDQCDSSSRE 64 VR L + +SG R + +CG+ DQC++S + Sbjct 1078 VRLLADLLSGIERVVDEWKVAECGISDQCNASENQ 1112 > At4g02990 Length=541 Score = 28.1 bits (61), Expect = 4.1, Method: Composition-based stats. Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 0/40 (0%) Query 31 RALCNSVSGNHRHSERRPAVQCGLLDQCDSSSRETRPRQL 70 R+L +S GN + ++RP GL QC ++R R L Sbjct 30 RSLSDSTYGNLCNHKKRPGTGIGLTVQCAIANRRFSSRSL 69 > CE26874 Length=682 Score = 26.9 bits (58), Expect = 9.1, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 17/26 (65%), Gaps = 1/26 (3%) Query 75 TGKELHRTEVKQLEKYESEERPCTCP 100 TGK+ H EV Q E+ E+EE+ CP Sbjct 205 TGKDCHTEEV-QTERGETEEKETQCP 229 Lambda K H 0.319 0.133 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184494980 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40