bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0763_orf2 Length=146 Score E Sequences producing significant alignments: (Bits) Value 7303919 30.0 1.5 CE06498 29.6 2.3 YLR440c 29.6 2.3 > 7303919 Length=520 Score = 30.0 bits (66), Expect = 1.5, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Query 72 QKEKTLLLVVIRVYEAFPVASPKGL-FQTDVGLR 104 Q+ KTL++V+++ ++ PV PK + FQ + LR Sbjct 472 QEMKTLMVVILKHFKILPVIDPKSIVFQVGITLR 505 > CE06498 Length=1307 Score = 29.6 bits (65), Expect = 2.3, Method: Composition-based stats. Identities = 12/49 (24%), Positives = 25/49 (51%), Gaps = 0/49 (0%) Query 52 YLFFLFKKSLFIFFKVFSFFQKEKTLLLVVIRVYEAFPVASPKGLFQTD 100 +++F ++ ++F FS F+ +L V++ + F V KG F + Sbjct 170 HVYFFTEQGTMLYFDRFSIFEPVNSLQFEVVKTGQTFIVVFTKGFFMIN 218 > YLR440c Length=709 Score = 29.6 bits (65), Expect = 2.3, Method: Composition-based stats. Identities = 18/76 (23%), Positives = 32/76 (42%), Gaps = 0/76 (0%) Query 4 LRHKKKYLWKSGKETLIRDSLWGVRTPRPQRASTHSDATARSFYFISFYLFFLFKKSLFI 63 L H + L+ T D LW + + P + T + F FF+ + F Sbjct 281 LFHNSENLFNLSSLTHKLDELWSILSGFPDEITIEEQKTITALEMKQFMEFFIKCSTKFS 340 Query 64 FFKVFSFFQKEKTLLL 79 F ++F+ Q+E++ L Sbjct 341 FKEIFAITQEEESAQL 356 Lambda K H 0.330 0.140 0.449 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1748847648 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40