bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0672_orf2 Length=74 Score E Sequences producing significant alignments: (Bits) Value CE27977 31.2 0.44 CE04406 31.2 0.44 At4g15190 28.9 2.1 At4g37330 28.5 2.9 7290249 28.5 2.9 CE06121 28.5 3.6 At1g68920 28.1 4.1 At5g15260 28.1 4.5 At4g07840 26.9 9.4 > CE27977 Length=734 Score = 31.2 bits (69), Expect = 0.44, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Query 14 NEGLRFFAFVRNESEDAKAEKENGSRIRSERTQQQRQQPEIDRDA------KRSEEAEPD 67 N F AFVR+ S EKE G+R +S + R+ ++ DA R+E +PD Sbjct 668 NLAAAFIAFVRDASRPGNDEKECGTRSKSFSLTECRKSLDLTNDALFNAVLARAEILQPD 727 > CE04406 Length=731 Score = 31.2 bits (69), Expect = 0.44, Method: Composition-based stats. Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 6/60 (10%) Query 14 NEGLRFFAFVRNESEDAKAEKENGSRIRSERTQQQRQQPEIDRDA------KRSEEAEPD 67 N F AFVR+ S EKE G+R +S + R+ ++ DA R+E +PD Sbjct 665 NLAAAFIAFVRDASRPGNDEKECGTRSKSFSLTECRKSLDLTNDALFNAVLARAEILQPD 724 > At4g15190 Length=130 Score = 28.9 bits (63), Expect = 2.1, Method: Compositional matrix adjust. Identities = 12/18 (66%), Positives = 14/18 (77%), Gaps = 0/18 (0%) Query 8 HCRSLKNEGLRFFAFVRN 25 H +S KNEGLR FA VR+ Sbjct 44 HGKSAKNEGLRLFAIVRD 61 > At4g37330 Length=492 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 0/48 (0%) Query 10 RSLKNEGLRFFAFVRNESEDAKAEKENGSRIRSERTQQQRQQPEIDRD 57 + +KN G RF F++ ++ +AEKE G + Q QP+ D Sbjct 237 KRIKNLGNRFDTFLQKLVDEKRAEKEKGETMIDHLLALQDIQPDYYTD 284 > 7290249 Length=1398 Score = 28.5 bits (62), Expect = 2.9, Method: Composition-based stats. Identities = 14/36 (38%), Positives = 25/36 (69%), Gaps = 4/36 (11%) Query 29 DAKAEKENGSRIRSERTQ----QQRQQPEIDRDAKR 60 +A A ENGS+ +SE +Q Q+++QP+ +R+ K+ Sbjct 5 EAAAAGENGSQAKSEESQPPEDQKKKQPQHERNEKQ 40 > CE06121 Length=502 Score = 28.5 bits (62), Expect = 3.6, Method: Composition-based stats. Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 0/36 (0%) Query 26 ESEDAKAEKENGSRIRSERTQQQRQQPEIDRDAKRS 61 + E K K G R E+ QQ ++ E+D+D +++ Sbjct 86 KDESKKGNKTKGKRNSKEKKNQQAEKTELDKDCQKA 121 > At1g68920 Length=486 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 4/49 (8%) Query 24 RNESEDAKAEKENGSR----IRSERTQQQRQQPEIDRDAKRSEEAEPDS 68 R S + K K NG + +S R+QQ ++P+ + D KR++E P+S Sbjct 229 RETSSNTKKRKRNGQKNSEAAQSHRSQQSEEEPDNNGDEKRNDEQSPNS 277 > At5g15260 Length=294 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 8/62 (12%) Query 4 CGGPHCRSLKNEGLRFFAFVRNESEDAKAEKENGSRIRSERTQQQRQQPEIDRDAKRSEE 63 CG P+C+ L+ F ++ E+ED +G + ++ E+ RD R E Sbjct 122 CGKPNCKGLRKANAEF--DIQLETEDCVKSSNSGKSV------SKKGLFELPRDHHRELE 173 Query 64 AE 65 AE Sbjct 174 AE 175 > At4g07840 Length=769 Score = 26.9 bits (58), Expect = 9.4, Method: Composition-based stats. Identities = 11/27 (40%), Positives = 17/27 (62%), Gaps = 0/27 (0%) Query 14 NEGLRFFAFVRNESEDAKAEKENGSRI 40 NE ++ F F+RNE E +K +GS + Sbjct 526 NEAIKEFDFIRNEEEPCVYKKTSGSAV 552 Lambda K H 0.310 0.130 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1184572648 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40