bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0672_orf13 Length=51 Score E Sequences producing significant alignments: (Bits) Value CE17316 29.3 1.8 ECU11g1570 28.1 4.6 > CE17316 Length=308 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 1/19 (5%) Query 2 CCHFLFLPLHLLTRFLRRR 20 CC + F P H+ TRFL RR Sbjct 109 CCQYFF-PFHIFTRFLSRR 126 > ECU11g1570 Length=347 Score = 28.1 bits (61), Expect = 4.6, Method: Composition-based stats. Identities = 13/45 (28%), Positives = 22/45 (48%), Gaps = 2/45 (4%) Query 2 CCHFLFLPLHLLTRFLRRRKTLNP--RFLGSGSAGHRSQVFRWFR 44 C +FL + + R+++ L P G G+ H + +RWFR Sbjct 225 CLSSIFLRISSIKLIERKKEALTPGQPLPGKGTCKHYRKSYRWFR 269 Lambda K H 0.337 0.150 0.536 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161614636 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40