bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0672_orf12 Length=67 Score E Sequences producing significant alignments: (Bits) Value Hs11761629 29.6 1.6 Hs4503689_1 29.6 1.6 At2g45970 29.3 1.8 > Hs11761629 Length=644 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 3 SHAPCSSPFPLRGVESSYSKGDFCSYSY 30 SH P + FP RG SSYSK S SY Sbjct 562 SHHPGIAEFPSRGKSSSYSKQFTSSTSY 589 > Hs4503689_1 Length=630 Score = 29.6 bits (65), Expect = 1.6, Method: Composition-based stats. Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 0/28 (0%) Query 3 SHAPCSSPFPLRGVESSYSKGDFCSYSY 30 SH P + FP RG SSYSK S SY Sbjct 562 SHHPGIAEFPSRGKSSSYSKQFTSSTSY 589 > At2g45970 Length=537 Score = 29.3 bits (64), Expect = 1.8, Method: Composition-based stats. Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 0/35 (0%) Query 33 TFCFICVSFAAYCLWFRFVSSCLPWPYSSLYLGSL 67 T I + AY LW F+S CL P LGSL Sbjct 5 TALMILSAITAYFLWLTFISRCLKGPRVWPILGSL 39 Lambda K H 0.330 0.141 0.515 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1160559522 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40