bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0662_orf2 Length=113 Score E Sequences producing significant alignments: (Bits) Value At5g03940 28.9 2.4 Hs20471942 28.9 2.5 SPAC11G7.03 27.7 4.8 Hs18765692 27.7 6.0 Hs17486012 26.9 9.6 > At5g03940 Length=564 Score = 28.9 bits (63), Expect = 2.4, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%) Query 59 LKNFRGPLQGPSSPAAHGNMDSEAEWTAVPPDRSRESRDGLSDEEKQGIE 108 +KN G ++G S PA G D+ PP +R R +D K+ +E Sbjct 502 MKNLMGVMEGGSIPALSGLEDALKAEQKAPPGTARRKRK--ADSRKKFVE 549 > Hs20471942 Length=571 Score = 28.9 bits (63), Expect = 2.5, Method: Compositional matrix adjust. Identities = 19/74 (25%), Positives = 29/74 (39%), Gaps = 16/74 (21%) Query 28 HHTAAEMHQLSSHVRPPQWQVLCLTTNYGSILK----------------NFRGPLQGPSS 71 HH A+ + ++ +RP + QV C + GS+L G +Q P + Sbjct 246 HHNLADTDRATNMIRPQKAQVQCCSKAVGSMLSLQVTSWLRAEPLSMTGYPEGQIQPPET 305 Query 72 PAAHGNMDSEAEWT 85 A G EWT Sbjct 306 TACMGLTSGSVEWT 319 > SPAC11G7.03 Length=356 Score = 27.7 bits (60), Expect = 4.8, Method: Composition-based stats. Identities = 16/37 (43%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Query 32 AEMHQLSSHVRPPQWQVLCLTTNYGSILKNFRGPLQG 68 A M +S RP Q+ VL + YGSIL N L G Sbjct 226 ASMQAVS---RPQQFDVLVMPNLYGSILSNIGSALVG 259 > Hs18765692 Length=1575 Score = 27.7 bits (60), Expect = 6.0, Method: Compositional matrix adjust. Identities = 17/70 (24%), Positives = 33/70 (47%), Gaps = 4/70 (5%) Query 17 DEGARLGYANVHHTAAEMHQLSSHVRPPQWQVLCLTTNYGSILKNFRGPLQGPSSPAAHG 76 ++GAR A T ++ L + + + ++L + +IL + P +GPS P Sbjct 1098 NKGARCAQAGSQKTCTQLADLEAVLESSEEEIL----HAAAILASLEIPQEGPSQPTKWS 1153 Query 77 NMDSEAEWTA 86 ++ +EA A Sbjct 1154 HLATEARALA 1163 > Hs17486012 Length=842 Score = 26.9 bits (58), Expect = 9.6, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 0/27 (0%) Query 27 VHHTAAEMHQLSSHVRPPQWQVLCLTT 53 +H T A L ++ PPQ+ +CL T Sbjct 439 IHETDAFFDYLFNYYEPPQYTRICLET 465 Lambda K H 0.314 0.130 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1185472426 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40