bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0662_orf1 Length=116 Score E Sequences producing significant alignments: (Bits) Value At1g74690 29.3 1.9 CE27773 28.9 2.4 CE29124 27.7 6.0 CE25927 26.9 9.0 At3g48500 26.9 9.6 > At1g74690 Length=553 Score = 29.3 bits (64), Expect = 1.9, Method: Compositional matrix adjust. Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Query 21 GPVVQRSIQP-RSPYFRVQQEKMDPEAGRESS 51 PVV+ SIQP RSP V++ K+ E RESS Sbjct 319 NPVVESSIQPQRSPRKEVEKPKLGVEKTRESS 350 > CE27773 Length=4063 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 14/28 (50%), Positives = 15/28 (53%), Gaps = 0/28 (0%) Query 58 WLSDKEPAIAAGEREKTTGAFPQLYGVH 85 WLSDKE +A GE TT A L H Sbjct 2637 WLSDKETQVARGELGDTTDAVEMLIKGH 2664 > CE29124 Length=530 Score = 27.7 bits (60), Expect = 6.0, Method: Composition-based stats. Identities = 19/76 (25%), Positives = 42/76 (55%), Gaps = 8/76 (10%) Query 1 GIFQYLASLHLTAHLGILWNGPVVQRSIQPRSPYFRVQQEKMDPEAGRESSSELNRNWLS 60 G ++ +L+LT ++ I+ NG V R+++ ++EK+ + G E+ +++R+ Sbjct 2 GRVSWIIALYLTINVVIVVNGDRVTRNVE-----VTAEEEKIRDKLGYEAIRDIHRDMDD 56 Query 61 DKEPAIAAGEREKTTG 76 D +I +R ++TG Sbjct 57 DHSGSI---DRNESTG 69 > CE25927 Length=2735 Score = 26.9 bits (58), Expect = 9.0, Method: Composition-based stats. Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 0/22 (0%) Query 14 HLGILWNGPVVQRSIQPRSPYF 35 HLG+ +N P V R++ + PYF Sbjct 2325 HLGVTFNFPPVNRTLARQPPYF 2346 > At3g48500 Length=684 Score = 26.9 bits (58), Expect = 9.6, Method: Composition-based stats. Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Query 19 WNGPVVQRSIQPRS-PYFRVQQEKMDPEAGRESSSEL-NRNWLSDKEPAIAAGE 70 W GP+V R I PR P + ++ + E RE+ + R WL D + + GE Sbjct 154 WAGPMVLRQIPPRDWPPRGWEVDRKELEFIREAHKLMAERVWLEDLDKDLRVGE 207 Lambda K H 0.315 0.132 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1174970866 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40