bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0641_orf3 Length=89 Score E Sequences producing significant alignments: (Bits) Value At5g46560 30.4 0.80 At4g36860 29.3 1.6 7301115 28.1 4.6 ECU05g0940 27.3 6.4 > At5g46560 Length=375 Score = 30.4 bits (67), Expect = 0.80, Method: Composition-based stats. Identities = 18/45 (40%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Query 14 LEASSVSWSATL-RLVVDCGGVLITLSVHRRAIQYERCIVRRYCE 57 L +S+ +A L LVV C G+L+ ++ RR IQ ++C RR E Sbjct 211 LSLASMDLAAYLNHLVVLCNGILVGSAMLRRRIQRKQCFSRRVEE 255 > At4g36860 Length=542 Score = 29.3 bits (64), Expect = 1.6, Method: Composition-based stats. Identities = 9/17 (52%), Positives = 13/17 (76%), Gaps = 0/17 (0%) Query 52 VRRYCEGIKRDGLPRCC 68 +++YC +RDG PRCC Sbjct 260 MQKYCPSHERDGTPRCC 276 > 7301115 Length=1067 Score = 28.1 bits (61), Expect = 4.6, Method: Composition-based stats. Identities = 13/34 (38%), Positives = 21/34 (61%), Gaps = 0/34 (0%) Query 22 SATLRLVVDCGGVLITLSVHRRAIQYERCIVRRY 55 S TL+++ + GG+L +S H + R I+RRY Sbjct 296 SKTLKIIENAGGILRNVSSHIAVCEPYRQILRRY 329 > ECU05g0940 Length=1337 Score = 27.3 bits (59), Expect = 6.4, Method: Composition-based stats. Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Query 18 SVSWSATLRLVVDCGGVLITLSVHRRAIQYERCIVRRYCEGIK 60 S ++ LVVD GG LIT R ++YE + Y G+K Sbjct 18 SAQFTGIGHLVVD-GGALITNISKRYGVKYESLPLHTYMHGVK 59 Lambda K H 0.327 0.139 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181033294 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40