bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0641_orf1 Length=89 Score E Sequences producing significant alignments: (Bits) Value Hs18588112 28.9 2.2 7290117 28.1 4.0 > Hs18588112 Length=362 Score = 28.9 bits (63), Expect = 2.2, Method: Composition-based stats. Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 0/25 (0%) Query 13 CWYANRTCLQQRGSPSLLIPSQYRL 37 CW Q+ G+PS L+P Q++L Sbjct 132 CWLRKAPSRQEEGAPSRLVPPQFQL 156 > 7290117 Length=563 Score = 28.1 bits (61), Expect = 4.0, Method: Composition-based stats. Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 0/34 (0%) Query 14 WYANRTCLQQRGSPSLLIPSQYRLTMHRSYWIAL 47 W N+ LQQ+ S PS + L + YW L Sbjct 99 WSKNKNFLQQKSSTCAKYPSIFELEFNNIYWQTL 132 Lambda K H 0.321 0.132 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1181033294 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40