bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0562_orf8 Length=145 Score E Sequences producing significant alignments: (Bits) Value At2g38460 30.4 1.1 CE10364 30.4 1.4 At2g13790 29.6 1.8 7290539 27.7 7.4 > At2g38460 Length=524 Score = 30.4 bits (67), Expect = 1.1, Method: Composition-based stats. Identities = 13/40 (32%), Positives = 20/40 (50%), Gaps = 0/40 (0%) Query 86 RNSFWGFWARWLRGVCCCGQRGVRTLQFAFFGLLPEVACS 125 R W FW++W + C G V+ + A + L+ VA S Sbjct 378 RTGLWSFWSQWSCLLVCVGSIWVKKDKIASYMLMAGVAAS 417 > CE10364 Length=2034 Score = 30.4 bits (67), Expect = 1.4, Method: Composition-based stats. Identities = 13/38 (34%), Positives = 16/38 (42%), Gaps = 8/38 (21%) Query 10 QRGVRTPRGGVLRGAACRSSSSCCCCCCSCCCCCSCCC 47 QRGV+ P+ C + C C CC C C C Sbjct 1839 QRGVKCPK--------CCTRRGCLCKCCIFCFETKCLC 1868 > At2g13790 Length=520 Score = 29.6 bits (65), Expect = 1.8, Method: Composition-based stats. Identities = 13/26 (50%), Positives = 14/26 (53%), Gaps = 0/26 (0%) Query 22 RGAACRSSSSCCCCCCSCCCCCSCCC 47 RGA S+S CC CS CCS C Sbjct 141 RGANDCSNSRGSCCRCSTSICCSSHC 166 > 7290539 Length=592 Score = 27.7 bits (60), Expect = 7.4, Method: Composition-based stats. Identities = 11/24 (45%), Positives = 13/24 (54%), Gaps = 3/24 (12%) Query 29 SSSCCCCCCSCCCCCSCCCFLRKR 52 S + CCC CS C CC+ KR Sbjct 246 SKALCCCLCS---NCGYCCYDEKR 266 Score = 27.3 bits (59), Expect = 9.4, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 10/16 (62%), Gaps = 0/16 (0%) Query 28 SSSSCCCCCCSCCCCC 43 S + CCC C +C CC Sbjct 246 SKALCCCLCSNCGYCC 261 Lambda K H 0.334 0.141 0.525 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1712413322 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40