bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0562_orf6 Length=156 Score E Sequences producing significant alignments: (Bits) Value Hs22043298 34.3 0.11 7303930 32.3 0.37 7298115 29.6 2.7 Hs18546740 28.9 4.6 > Hs22043298 Length=139 Score = 34.3 bits (77), Expect = 0.11, Method: Compositional matrix adjust. Identities = 34/114 (29%), Positives = 47/114 (41%), Gaps = 16/114 (14%) Query 26 DTSGRGAPRRSLPQQQQLLLLLLFLLLLLFLLLLPQEAHLPRCPSFCCCCCDARPLAAAA 85 DT G+ RS P + L +LP A LPRCP DAR ++ A Sbjct 2 DTRAEGSLARSAPP------------VFLIASILPTVAQLPRCPYLVTEVWDARKRSSWA 49 Query 86 AAAAALGSSVRAKQLLGF-LGPLAARRLLLRAARC--TYTAVRLLRAPPRGRLQ 136 A A V G L P +RL+ A+ TAV+++ APP ++ Sbjct 50 QWACATLEEVVLNPFRGINLFPWFYKRLVKDIAKVAPANTAVQVI-APPERKIS 102 > 7303930 Length=519 Score = 32.3 bits (72), Expect = 0.37, Method: Composition-based stats. Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 0/43 (0%) Query 13 ELRRASGPAAGCTDTSGRGAPRRSLPQQQQLLLLLLFLLLLLF 55 E +R+SG +A T G P+ S PQ + LL F+L+LLF Sbjct 31 EKQRSSGASAIAVGTEFPGNPQASRPQSLGMYLLEPFILILLF 73 > 7298115 Length=611 Score = 29.6 bits (65), Expect = 2.7, Method: Compositional matrix adjust. Identities = 22/63 (34%), Positives = 30/63 (47%), Gaps = 1/63 (1%) Query 43 LLLLLLFLLLLLFLLLLPQ-EAHLPRCPSFCCCCCDARPLAAAAAAAAALGSSVRAKQLL 101 L ++L F LL F + Q E PR P C D R + A +LGSSV +++L Sbjct 513 LSIVLQFQLLKHFCTITGQFEMGNPRKPLDMCDLSDQRGIGEILKRAMSLGSSVHYREVL 572 Query 102 GFL 104 L Sbjct 573 KVL 575 > Hs18546740 Length=295 Score = 28.9 bits (63), Expect = 4.6, Method: Compositional matrix adjust. Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 0/34 (0%) Query 119 CTYTAVRLLRAPPRGRLQQLQRQQQQQQQQQLPR 152 C R+ +APP +L++L+R+ +Q +Q +PR Sbjct 181 CMIPDFRVPKAPPLVKLKRLERKHKQAEQVSVPR 214 Lambda K H 0.331 0.141 0.435 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2070320142 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40