bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0562_orf5 Length=113 Score E Sequences producing significant alignments: (Bits) Value CE03241 29.6 1.4 Hs4506809 28.1 4.6 > CE03241 Length=361 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 16/36 (44%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Query 38 RLLLLPLL-LLLPLLLLLALLLLLLLWLQQQLLRRH 72 R L LP++ L++ LLL +L +L+WL+Q+L R H Sbjct 324 RNLFLPVIYLVVGTFLLLVTILFILIWLKQRLSRVH 359 > Hs4506809 Length=2016 Score = 28.1 bits (61), Expect = 4.6, Method: Compositional matrix adjust. Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Query 81 RCRCCCCCCRCCCCRRCCCCCCCFT------WWRLRK 111 + C C RRC CC T WWRLRK Sbjct 1160 DVKDPEDCFTEGCVRRCPCCAVDTTQAPGKVWWRLRK 1196 Lambda K H 0.345 0.156 0.641 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1185472426 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40