bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0562_orf3 Length=103 Score E Sequences producing significant alignments: (Bits) Value 7291428 27.7 5.0 7296061 26.9 9.2 > 7291428 Length=1991 Score = 27.7 bits (60), Expect = 5.0, Method: Compositional matrix adjust. Identities = 9/30 (30%), Positives = 28/30 (93%), Gaps = 0/30 (0%) Query 57 EQKQQQQRQQQQQRQQQQQRQQQQPQQQQQ 86 EQ++++QR+++Q+ ++Q++R+Q++ +Q+++ Sbjct 1422 EQREKEQREKEQREKEQREREQREKEQREK 1451 > 7296061 Length=1316 Score = 26.9 bits (58), Expect = 9.2, Method: Compositional matrix adjust. Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 4/47 (8%) Query 60 QQQQRQQQQQRQQQQQRQQQQPQQQQ----QRFAGKPSRGCGPPRVI 102 + +R QQ+ R QQ Q QP QQQ Q + + R PP V+ Sbjct 1023 LRNERHQQRHRNDQQWEQPYQPAQQQHQRLQYYMPQTERCTSPPDVV 1069 Lambda K H 0.312 0.114 0.306 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1177719780 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40