bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0507_orf1 Length=100 Score E Sequences producing significant alignments: (Bits) Value Hs20544189_1 30.0 1.1 At5g27680 29.6 1.3 CE20906 28.9 2.6 SPAC22E12.09c 28.9 2.6 CE18872 28.1 4.5 7291221_1 28.1 4.7 > Hs20544189_1 Length=4057 Score = 30.0 bits (66), Expect = 1.1, Method: Composition-based stats. Identities = 14/34 (41%), Positives = 17/34 (50%), Gaps = 8/34 (23%) Query 32 RMQHSRCI----YTAESCGARVCAVQTPAACSPR 61 R ++ RC+ YT E CG R C P CS R Sbjct 289 RCENGRCVCNPGYTGEDCGVRSC----PRGCSQR 318 > At5g27680 Length=819 Score = 29.6 bits (65), Expect = 1.3, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 0/74 (0%) Query 6 KRGRVYIHQESGRSHKTKEDRKALCMRMQHSRCIYTAESCGARVCAVQTPAACSPRPVHL 65 KR + G S R+AL + H C+ A + + Q PA + + V + Sbjct 154 KRVNSILRNRFGISSLRSFQREALSTWVAHKDCLVLAATGSGKSLCFQIPALLTGKVVVV 213 Query 66 LLPTTSLKAQKCFK 79 + P SL +C K Sbjct 214 ISPLISLMHDQCLK 227 > CE20906 Length=501 Score = 28.9 bits (63), Expect = 2.6, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 0/28 (0%) Query 8 GRVYIHQESGRSHKTKEDRKALCMRMQH 35 R IH +S R + K DRKAL R++H Sbjct 323 NRYDIHDKSKRDAREKRDRKALRHRVRH 350 > SPAC22E12.09c Length=709 Score = 28.9 bits (63), Expect = 2.6, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Query 49 VCAVQTPAACSPRPVHLLLPTTSLKAQKCFKNI-----YFVLFTFVY 90 V A TP + S P+ +LP T + ++ I +F+LF F++ Sbjct 637 VSATATPTSTSHIPIPTVLPPTQPVLEPSYREIVAFITFFLLFAFIF 683 > CE18872 Length=681 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 18/73 (24%), Positives = 31/73 (42%), Gaps = 2/73 (2%) Query 4 VAKRGRVYIHQESGRSHKTKEDRKALCMRMQHSRCIYTAESCGARVCAVQTPAACSPRPV 63 +A R +I E+G K D+ A +++ S R C + C PRP Sbjct 347 IAMRPHTFI--EAGIKAMRKCDKCATALKLATSMKCRDCHQVVHRSCCNKLHLPCIPRPK 404 Query 64 HLLLPTTSLKAQK 76 ++ P ++L+ K Sbjct 405 TMMTPKSALRGAK 417 > 7291221_1 Length=569 Score = 28.1 bits (61), Expect = 4.7, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 5/41 (12%) Query 8 GRVYIHQESGRSHKTKEDRKALC--MRMQHSRCIYTAESCG 46 G+++I E G+S K + +AL R HS IYT E CG Sbjct 445 GKLFICSECGKSCK---NSRALIGHKRYSHSNVIYTCEQCG 482 Lambda K H 0.332 0.137 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1187882580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40