bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0469_orf2 Length=200 Score E Sequences producing significant alignments: (Bits) Value YCR093w 38.1 0.011 Hs16933525 29.6 4.4 7292158 29.3 4.9 CE28524 28.5 8.2 > YCR093w Length=2108 Score = 38.1 bits (87), Expect = 0.011, Method: Composition-based stats. Identities = 17/41 (41%), Positives = 26/41 (63%), Gaps = 0/41 (0%) Query 146 VKATLLLHVQHQQLRPEAEVFPDTAFAMDEVACLLAQDGAP 186 V+A L + ++ RP E+ P FA+DEV+C + Q+GAP Sbjct 742 VEAATLANAPKERSRPVQEMIPLKFFAVDEVSCQINQEGAP 782 > Hs16933525 Length=931 Score = 29.6 bits (65), Expect = 4.4, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 12/52 (23%) Query 118 VAGNSTSRAAAQRV-----GPLCCRLLQH----VC---TQVKATLLLHVQHQ 157 + G+ST++AAA+R+ GPLCC L++ C TQ +LH++ Q Sbjct 669 LVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ 720 > 7292158 Length=1240 Score = 29.3 bits (64), Expect = 4.9, Method: Compositional matrix adjust. Identities = 12/33 (36%), Positives = 22/33 (66%), Gaps = 0/33 (0%) Query 145 QVKATLLLHVQHQQLRPEAEVFPDTAFAMDEVA 177 ++K+ ++V Q+ PE EVFP+ A +++ VA Sbjct 278 EIKSEAPVNVSQQERTPEDEVFPEEAISLEGVA 310 > CE28524 Length=777 Score = 28.5 bits (62), Expect = 8.2, Method: Composition-based stats. Identities = 19/69 (27%), Positives = 33/69 (47%), Gaps = 2/69 (2%) Query 10 VFTSLSGQXXINSG--SVAARRAHRDSQSLSFLLQQNRAAGATNIKVACCQSQKNLPRHL 67 + TS S Q +N V + RAH S+ LL + +GA + ++++ LP + Sbjct 689 LLTSASHQQVLNRSIDEVMSMRAHAGSEEPQTLLDTQKMSGALPWRSLASETRRELPTAM 748 Query 68 LLLLLLLLL 76 +L+L L Sbjct 749 ASILVLGFL 757 Lambda K H 0.324 0.132 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 3479363422 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40