bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0040_orf1 Length=95 Score E Sequences producing significant alignments: (Bits) Value Hs18373328 27.7 4.9 At1g55180 26.9 8.7 HsM4505103 26.9 10.0 > Hs18373328 Length=225 Score = 27.7 bits (60), Expect = 4.9, Method: Compositional matrix adjust. Identities = 17/52 (32%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Query 35 SNDFGVTHLLGVQE-GSELQKSSELNFSLGCRQQSNAEGSLLGEAEQRFASS 85 +D G HL V E GS + +S +N G + +S G LL F+S+ Sbjct 32 PDDGGTAHLSVVAEDGSAVSATSTINLYFGSKVRSPVSGILLNNEMDDFSST 83 > At1g55180 Length=762 Score = 26.9 bits (58), Expect = 8.7, Method: Composition-based stats. Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 0/45 (0%) Query 13 EQKLFLGFEGGVVIQTNLLVVASNDFGVTHLLGVQEGSELQKSSE 57 E L + G + NL++V N+ + H +GV G L++ SE Sbjct 202 ESARHLVYIAGWALNPNLVLVRDNETEIPHAVGVTVGELLKRKSE 246 > HsM4505103 Length=713 Score = 26.9 bits (58), Expect = 10.0, Method: Composition-based stats. Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 0/56 (0%) Query 26 IQTNLLVVASNDFGVTHLLGVQEGSELQKSSELNFSLGCRQQSNAEGSLLGEAEQR 81 IQ +L + ++ T+LL ++ SE++ SS+LN S G + S+ +QR Sbjct 345 IQESLSKMKYDEITATYLLLGRKSSEVRPSSDLNNSTGQSPHHKVQRSVSSSQKQR 400 Lambda K H 0.306 0.125 0.330 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1161385214 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40